PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC599_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 292aa    MW: 32219.9 Da    PI: 6.5036
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC599_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.72.9e-163191257
               T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
               r+R+++++eq+ +Le+ F++   +p +ee  ++ k l    ++ +++V++WFqNrR + ++
  RrC599_p1 31 RSRWSPKPEQILILESIFNSgMVNPPKEETVRIRKMLekfgKVGDANVFYWFQNRRSRSRR 91
               89*****************99*************************************997 PP

2Wus_type_Homeobox108.34.5e-353093265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RW+P+peQi iLe++++sG+++P+kee+ ri+++Le++Gk++d+NVfyWFQNr++R+r++q
          RrC599_p1 30 VRSRWSPKPEQILILESIFNSGMVNPPKEETVRIRKMLEKFGKVGDANVFYWFQNRRSRSRRRQ 93
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.67E-142398IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-92598IPR009057Homeodomain-like
PROSITE profilePS5007111.582792IPR001356Homeobox domain
SMARTSM003892.6E-62996IPR001356Homeobox domain
PfamPF000465.2E-143191IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDKEQKPHST TGHSHSPSSS ASGSTSTETV RSRWSPKPEQ ILILESIFNS GMVNPPKEET  60
VRIRKMLEKF GKVGDANVFY WFQNRRSRSR RRQRQLQAAA AEAATITNTC EQTMMVSNNL  120
PQHNGSDLGF GALLIIYLFL PSFFVFLSSY PPSCESSSST SSASSSYGAG CDDHSNNGME  180
NLLTMSGQMG YHEANQHHYN YHSSNVESIL CPSDQSSNYH YQQGSIMVFI NGVPTEVTSG  240
GIDMKASFGE DLVLVNSSGV PLPTDQFGFL MHSLQHGEAY FLVIVQISYI LC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2514021e-124AY251402.1 Arabidopsis thaliana WOX11 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009130381.11e-141PREDICTED: WUSCHEL-related homeobox 11-like
SwissprotQ6X7J31e-138WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLM4ET501e-141M4ET50_BRARP; Uncharacterized protein
STRINGBra031980.1-P1e-140(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28192768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.11e-117WUSCHEL related homeobox 11